PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang10g05410.1
Common NameLR48_Vigan11g091400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 235aa    MW: 26055.5 Da    PI: 9.9314
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang10g05410.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.32e-1494138347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + ++lG+g+W+ I+r + ++Rt+ q+ s+ qky
   Vang10g05410.1  94 PWTEEEHRIFLVGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKY 138
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.60.104.9E-4320IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.52787143IPR017930Myb domain
SuperFamilySSF466896.89E-1888143IPR009057Homeodomain-like
TIGRFAMsTIGR015575.0E-1890141IPR006447Myb domain, plants
SMARTSM007173.5E-1191141IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.5E-1291137IPR009057Homeodomain-like
CDDcd001678.82E-1094139No hitNo description
PfamPF002497.8E-1294138IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MGRKCSHCGV IGHNSRTCTS LRGSSFVGLR LFGVQLDTCV TIKKSFSMDS LPSSSSSSFS  60
SSRITIDENS DRTSFGYLSD GLIGRVQERK KGVPWTEEEH RIFLVGLEKL GKGDWRGISR  120
NFVTTRTPTQ VASHAQKYFL RLATIDKKKR RSSLFDVVGS NNVGGCNSVS GYHKKDDSKC  180
EVKNSDATLS LLGRITYFQQ ESKSDYKKQE KLENCPHQVP NLELTLRSCL GQLV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1146150KKKRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00565DAPTransfer from AT5G56840Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0311940.0KT031194.1 Glycine max clone HN_CCL_90 MYB/HD-like transcription factor (Glyma08g03330.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014507580.11e-171PREDICTED: transcription factor MYB1R1-like isoform X2
TrEMBLA0A0L9VS241e-173A0A0L9VS24_PHAAN; Uncharacterized protein
STRINGGLYMA05G36290.11e-121(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32133271
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.12e-54MYB_related family protein
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]